Structure of PDB 4ypb Chain R4 |
>4ypbR4 (length=70) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
KEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVD TEGRVERFQRRYGDSYRKGR |
|
PDB | 4ypb Defining the mRNA recognition signature of a bacterial toxin protein. |
Chain | R4 |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
R4 |
K2 H6 |
K1 H5 |
|
|
|
|