Structure of PDB 4lsk Chain R3

Receptor sequence
>4lskR3 (length=59) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVA
HLVRVEVVE
3D structure
PDB4lsk Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainR3
Resolution3.48001 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna R3 K10 S11 I13 G14 K17 A21 A22 K24 A25 R29 R30 L31 P41 A42 G45 N46 K49 K9 S10 I12 G13 K16 A20 A21 K23 A24 R28 R29 L30 P40 A41 G44 N45 K48
BS02 rna R3 Q19 H52 Q18 H51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4lsk, PDBe:4lsk, PDBj:4lsk
PDBsum4lsk
PubMed25128388
UniProtQ5SHQ6|RL30_THET8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]