Structure of PDB 7r81 Chain R2

Receptor sequence

>7r81R2 (length=139) Species: 5141 (Neurospora crassa)

QAVQVFGKKKNATAVARCVQGKGLIKVNGVPLKLYAPEILRAKLYEPILL
LGTDKFAEVDIRLKVSGGGHVSQVYAVRQAIAKAIVAYYAKYVDEHSKNT
LKTALIQFDRTLLVADPRRCEPKKFGGKGARSRFQKSYR

3D structure

• PDB: 7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
• Chain: R2
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R2	Q7 F9 K11 K12 K13 N14 V18 R20 K29 N31 R65 K67 S69 G70 G71 G72 H73 V74 S75 Q76 R113 P120 R121 R122 C123 E124 P125 K126 K127 F128 G132 R134 S135 R136 F137 Q138 K139 S140 Y141 R142	Q4 F6 K8 K9 K10 N11 V15 R17 K26 N28 R62 K64 S66 G67 G68 G69 H70 V71 S72 Q73 R110 P117 R118 R119 C120 E121 P122 K123 K124 F125 G129 R131 S132 R133 F134 Q135 K136 S137 Y138 R139

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7r81, PDBe:7r81, PDBj:7r81
• PDBsum: 7r81
• PubMed: 34815343
• UniProt: Q7SFJ9|RS16_NEUCR Small ribosomal subunit protein uS9 (Gene Name=rps-16)