Structure of PDB 7a01 Chain R2

Receptor sequence
>7a01R2 (length=35) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
PHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYAAP
3D structure
PDB7a01 The Halastavi arva Virus Intergenic Region IRES Promotes Translation by the Simplest Possible Initiation Mechanism.
ChainR2
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R2 P38 H39 C40 S41 R42 N43 R48 G49 S54 R55 S56 Y59 S60 R61 K62 Y65 K66 R67 Y69 P72 P1 H2 C3 S4 R5 N6 R11 G12 S17 R18 S19 Y22 S23 R24 K25 Y28 K29 R30 Y32 P35
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a01, PDBe:7a01, PDBj:7a01
PDBsum7a01
PubMed33296660
UniProtG1U1N5

[Back to BioLiP]