Structure of PDB 8r3v Chain R1

Receptor sequence
>8r3vR1 (length=74) Species: 562 (Escherichia coli) [Search protein sequence]
MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAK
YQRQLARAIKRARYLSLLPYTDRH
3D structure
PDB8r3v Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
ChainR1
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna R1 Y4 R6 R7 R8 K9 F10 A15 K38 I39 V40 P41 S42 K50 Q52 R53 K60 R61 Y64 Y70 T71 H74 Y4 R6 R7 R8 K9 F10 A15 K38 I39 V40 P41 S42 K50 Q52 R53 K60 R61 Y64 Y70 T71 H74
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8r3v, PDBe:8r3v, PDBj:8r3v
PDBsum8r3v
PubMed38409277
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]