Structure of PDB 7r81 Chain R1

Receptor sequence

>7r81R1 (length=168) Species: 5141 (Neurospora crassa)

VRYAATEIAPAKSARSRGSYLRVSFKNTRETAQAINGWKLQRAQKFLENV
LEKKEAVPMRRYAGGTGRAAQGKQFGVSRARWPAKSAEFLLGLLKNAEAN
ADAKGLDTGNLVVKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILT
ELSSRQRGARVRRAITAA

3D structure

• PDB: 7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
• Chain: R1
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R1	R3 Y4 R16 R18 Y21 R23 S25 F26 K27 R30 Q34 R43 R62 Y63 G65 G66 T67 G68 R69 A71 Q72 K74 Q75 R80 R82 W83 P84 K86 K96 N97 N101 Q118 V119 Q121 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 P138 Y139 M140 S141 S172 R173 R175 G176 R178 R180	R2 Y3 R15 R17 Y20 R22 S24 F25 K26 R29 Q33 R42 R61 Y62 G64 G65 T66 G67 R68 A70 Q71 K73 Q74 R79 R81 W82 P83 K85 K95 N96 N100 Q117 V118 Q120 R126 T128 Y129 R130 A131 H132 G133 R134 I135 N136 P137 Y138 M139 S140 S154 R155 R157 G158 R160 R162
BS02	rna	R1	A5 R61 R62 N120 Q121 P123	A4 R60 R61 N119 Q120 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7r81, PDBe:7r81, PDBj:7r81
• PDBsum: 7r81
• PubMed: 34815343
• UniProt: Q9HE25|RL17_NEUCR Large ribosomal subunit protein uL22 (Gene Name=rpl-17)