Structure of PDB 7oyc Chain R1

Receptor sequence

>7oycR1 (length=166) Species: 8355 (Xenopus laevis) [Search protein sequence]

SMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLII
RKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKLSWMRRMRI
LRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKAR
KKLLADQAEARRSKTK

3D structure

PDB

7oyc A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R1	R162 R163	R161 R162
BS02	rna	R1	S2 M3 R5 K8 R9 L10 G18 K19 K20 K21 W23 L24 P26 S37 R38 Q39 R42 K46 T56 V57 H58 S59 R60 A61 R62 C63 R64 R70 R74 H75 G77 I78 G79 R81 K82 G83 T84 A85 N86 A87 R88 P90 K92 L93 W95 M96 R97 R100 I101 R103 R104 R108 R110 R117 H118 Y120 H121 Y124 L125 K126 K128 N130 N134 K135 R136	S1 M2 R4 K7 R8 L9 G17 K18 K19 K20 W22 L23 P25 S36 R37 Q38 R41 K45 T55 V56 H57 S58 R59 A60 R61 C62 R63 R69 R73 H74 G76 I77 G78 R80 K81 G82 T83 A84 N85 A86 R87 P89 K91 L92 W94 M95 R96 R99 I100 R102 R103 R107 R109 R116 H117 Y119 H120 Y123 L124 K125 K127 N129 N133 K134 R135

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7oyc, PDBe:7oyc, PDBj:7oyc
PDBsum	7oyc
PubMed	36653451
UniProt	Q7ZYS1\|RL19_XENLA Large ribosomal subunit protein eL19 (Gene Name=rpl19)

[Back to BioLiP]