Structure of PDB 6gzx Chain R1

Receptor sequence

>6gzxR1 (length=113) Species: 300852 (Thermus thermophilus HB8)

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEKHGK

3D structure

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: R1
• Resolution: 4.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R1	A5 I6 R8 Y9 R11 R15 K16 R25 K41 R42 Y45 K49 E52 S53 A56 N57 V59 N60 Y75 D77 E78 G79 R84 L86 P87 R88 R90 G91 R92 I96 K97 K98 H102	A5 I6 R8 Y9 R11 R15 K16 R25 K41 R42 Y45 K49 E52 S53 A56 N57 V59 N60 Y75 D77 E78 G79 R84 L86 P87 R88 R90 G91 R92 I96 K97 K98 H102

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: Q5SHP3|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)