Structure of PDB 4ypb Chain R1

Receptor sequence

>4ypbR1 (length=97) Species: 300852 (Thermus thermophilus HB8)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

• PDB: 4ypb Defining the mRNA recognition signature of a bacterial toxin protein.
• Chain: R1
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R1	S2 K3 K10 R11 V14 A15 N16 Q19 R20 K25 G29 V30 G31 K32 K33 T34 T35 S38 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 R50 R52 R61 H66 R76 K88 K96 L97	S1 K2 K9 R10 V13 A14 N15 Q18 R19 K24 G28 V29 G30 K31 K32 T33 T34 S37 K38 R39 R40 Q41 Y42 P43 N44 Q46 K47 R49 R51 R60 H65 R75 K87 K95 L96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4ypb, PDBe:4ypb, PDBj:4ypb
• PDBsum: 4ypb
• PubMed: 26508639
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)