Structure of PDB 4tud Chain R1

Receptor sequence

>4tudR1 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

PDB

4tud Structural insights into translational recoding by frameshift suppressor tRNASufJ.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R1	S2 K3 K10 R11 V14 A15 N16 Q19 R20 A24 K25 V30 G31 K32 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 S65 H66 K69 R76 K78 K88 E93 L97 L98	S1 K2 K9 R10 V13 A14 N15 Q18 R19 A23 K24 V29 G30 K31 K32 T33 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 R60 S64 H65 K68 R75 K77 K87 E92 L96 L97

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4tud, PDBe:4tud, PDBj:4tud
PDBsum	4tud
PubMed	25352689
UniProt	P60494\|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)