Structure of PDB 1vvj Chain R1

Receptor sequence

>1vvjR1 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

PDB

1vvj Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.

Chain

Resolution

3.44 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R1	S2 K3 K10 I13 A15 N16 I18 R20 K25 R26 G28 V30 G31 K32 K33 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 R52 R61 S65 H66 R76 K78 K88 L94 L97 L98	S1 K2 K9 I12 A14 N15 I17 R19 K24 R25 G27 V29 G30 K31 K32 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 R51 R60 S64 H65 R75 K77 K87 L93 L96 L97

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vvj, PDBe:1vvj, PDBj:1vvj
PDBsum	1vvj
PubMed	25128388
UniProt	P60494\|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)