Structure of PDB 6bz7 Chain R0

Receptor sequence
>6bz7R0 (length=81) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
HKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVG
MGRDFTLFALVDGVVEFQDRGRLGRYVHVRP
3D structure
PDB6bz7 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
ChainR0
Resolution3.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R0 H3 S9 N12 R14 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 T43 G54 R55 D56 F60 F69 R74 L75 R77 H1 S7 N10 R12 S14 Q15 A16 K17 R18 K22 Y24 E25 Q27 R30 A31 G32 N33 I34 R37 R39 T41 G52 R53 D54 F58 F67 R72 L73 R75
BS02 rna R0 R72 R74 R70 R72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bz7, PDBe:6bz7, PDBj:6bz7
PDBsum6bz7
PubMed30476222
UniProtP60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]