Structure of PDB 8y38 Chain R

Receptor sequence
>8y38R (length=89) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVA
SVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
3D structure
PDB8y38 Synthetic macrolides overcoming MLS B K-resistant pathogens.
ChainR
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R T13 E14 K15 K24 R32 N34 K35 T36 K39 M40 N54 I55 N57 Y58 K63 M65 Y68 G70 N73 K74 R76 I79 T12 E13 K14 K23 R31 N33 K34 T35 K38 M39 N53 I54 N56 Y57 K62 M64 Y67 G69 N72 K73 R75 I78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y38, PDBe:8y38, PDBj:8y38
PDBsum8y38
PubMed38992047
UniProtQ7A078|RL23_STAAW Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]