Structure of PDB 8xzh Chain R

Receptor sequence
>8xzhR (length=303) Species: 9606 (Homo sapiens) [Search protein sequence]
ECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSRSADIFIASLA
VADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTG
LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGD
LENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYF
FIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYM
LGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTS
MLC
3D structure
PDB8xzh Cryo-EM structure of the MM07-bound human APLNR-Gi complex
ChainR
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R Y93 I109 F110 V164 R168 C181 M183 W195 E198 Y271 F291 Y299 Y71 I87 F88 V142 R146 C159 M161 W173 E176 Y249 F269 Y277
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
GO:0060182 apelin receptor activity
Biological Process
GO:0001525 angiogenesis
GO:0001568 blood vessel development
GO:0001570 vasculogenesis
GO:0001944 vasculature development
GO:0001947 heart looping
GO:0003171 atrioventricular valve development
GO:0003272 endocardial cushion formation
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007369 gastrulation
GO:0007507 heart development
GO:0007512 adult heart development
GO:0010468 regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0035886 vascular associated smooth muscle cell differentiation
GO:0035904 aorta development
GO:0043951 negative regulation of cAMP-mediated signaling
GO:0045766 positive regulation of angiogenesis
GO:0050878 regulation of body fluid levels
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0060183 apelin receptor signaling pathway
GO:0060412 ventricular septum morphogenesis
GO:0060841 venous blood vessel development
GO:0060976 coronary vasculature development
GO:1903589 positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:1903596 regulation of gap junction assembly
GO:1904022 positive regulation of G protein-coupled receptor internalization
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xzh, PDBe:8xzh, PDBj:8xzh
PDBsum8xzh
PubMed38428423
UniProtP35414|APJ_HUMAN Apelin receptor (Gene Name=APLNR)

[Back to BioLiP]