Structure of PDB 8xjn Chain R

Receptor sequence
>8xjnR (length=310) Species: 32630 (synthetic construct) [Search protein sequence]
CFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGV
VMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAA
LALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGL
SFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLP
LLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYIL
FRRAVLRRLQ
3D structure
PDB8xjn Structural basis for ligand recognition and activation of the prostanoid receptors
ChainR
Resolution3.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A1D5A R A31 C35 L78 V85 H89 M112 S181 W182 W258 L294 T298 Q301 A21 C25 L68 V75 H79 M102 S171 W172 W248 L284 T288 Q291
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004960 thromboxane receptor activity
GO:0004961 thromboxane A2 receptor activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0005515 protein binding
Biological Process
GO:0006939 smooth muscle contraction
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007584 response to nutrient
GO:0009410 response to xenobiotic stimulus
GO:0019229 regulation of vasoconstriction
GO:0030194 positive regulation of blood coagulation
GO:0032496 response to lipopolysaccharide
GO:0033574 response to testosterone
GO:0038193 thromboxane A2 signaling pathway
GO:0045471 response to ethanol
GO:0045766 positive regulation of angiogenesis
GO:0045777 positive regulation of blood pressure
GO:0045907 positive regulation of vasoconstriction
GO:0045987 positive regulation of smooth muscle contraction
GO:0071222 cellular response to lipopolysaccharide
GO:0090051 negative regulation of cell migration involved in sprouting angiogenesis
Cellular Component
GO:0001669 acrosomal vesicle
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016607 nuclear speck

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xjn, PDBe:8xjn, PDBj:8xjn
PDBsum8xjn
PubMed38446662
UniProtP21731|TA2R_HUMAN Thromboxane A2 receptor (Gene Name=TBXA2R)

[Back to BioLiP]