Structure of PDB 8was Chain R

Receptor sequence
>8wasR (length=282) Species: 9606 (Homo sapiens) [Search protein sequence]
TCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSNPLLSDGDLSTMI
GKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNI
VDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVS
RISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATH
IARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVT
IRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
3D structure
PDB8was Structural Visualization of de novo Transcription Initiation.
ChainR
Resolution6.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna R K189 R193 K155 R159
BS02 dna R N103 R104 R105 K178 G247 R248 S249 S252 V280 A281 T284 N69 R70 R71 K144 G213 R214 S215 S218 V246 A247 T250
BS03 ZN R C15 H18 C34 C2 H5 C21
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993 RNA polymerase II complex binding
GO:0003677 DNA binding
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0016407 acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
GO:0046966 nuclear thyroid hormone receptor binding
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0140297 DNA-binding transcription factor binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006338 chromatin remodeling
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006473 protein acetylation
GO:0010467 gene expression
GO:0019083 viral transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0051177 meiotic sister chromatid cohesion
GO:0051225 spindle assembly
GO:0051276 chromosome organization
GO:0070897 transcription preinitiation complex assembly
GO:1904798 positive regulation of core promoter binding
GO:1990114 RNA polymerase II core complex assembly
Cellular Component
GO:0000776 kinetochore
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005694 chromosome
GO:0016604 nuclear body
GO:0032153 cell division site
GO:0032993 protein-DNA complex
GO:0042585 germinal vesicle
GO:0090575 RNA polymerase II transcription regulator complex
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8was, PDBe:8was, PDBj:8was
PDBsum8was
PubMed38127763
UniProtQ00403|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]