Structure of PDB 8uql Chain R

Receptor sequence

>8uqlR (length=121) Species: 562 (Escherichia coli)

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKPGVRYHTVRGALD
CSGVKDRKQARSKYGVKRPKA

3D structure

• PDB: 8uql Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
• Chain: R
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	A2 N5 Q6 R9 R12 A13 R14 K15 S19 A26 C27 P28 Q29 K30 R31 N46 S47 A48 L49 R50 K51 T58 Y66 G68 G69 E70 R83 K88 R94 R110 K111 Q112 A113 R114 S115 K116 Y117 V119 K120 R121	A1 N4 Q5 R8 R11 A12 R13 K14 S18 A25 C26 P27 Q28 K29 R30 N45 S46 A47 L48 R49 K50 T57 Y65 G67 G68 E69 R82 K87 R91 R107 K108 Q109 A110 R111 S112 K113 Y114 V116 K117 R118

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0034336 misfolded RNA binding

Biological Process

• GO:0000372 Group I intron splicing
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0033120 positive regulation of RNA splicing
• GO:0034337 RNA folding
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8uql, PDBe:8uql, PDBj:8uql
• PDBsum: 8uql
• PubMed: 39117885
• UniProt: P0A7S3|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)