Structure of PDB 8u26 Chain R

Receptor sequence
>8u26R (length=284) Species: 9606 (Homo sapiens) [Search protein sequence]
NQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLV
NLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYS
MTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTE
TMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGIT
LWQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQV
YLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAF
3D structure
PDB8u26 Improving resolution and resolvability of single-particle cryoEM structures using Gaussian mixture models.
ChainR
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R F25 N85 N89 Y92 N96 M174 R177 M181 F268 Q284 Y287 F3 N63 N67 Y70 N74 M152 R155 M159 F232 Q248 Y251
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004995 tachykinin receptor activity
GO:0005515 protein binding
GO:0016496 substance P receptor activity
Biological Process
GO:0002118 aggressive behavior
GO:0002687 positive regulation of leukocyte migration
GO:0003051 angiotensin-mediated drinking behavior
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007217 tachykinin receptor signaling pathway
GO:0007611 learning or memory
GO:0007616 long-term memory
GO:0008217 regulation of blood pressure
GO:0008306 associative learning
GO:0009582 detection of abiotic stimulus
GO:0009725 response to hormone
GO:0010193 response to ozone
GO:0010634 positive regulation of epithelial cell migration
GO:0010996 response to auditory stimulus
GO:0014070 response to organic cyclic compound
GO:0014910 regulation of smooth muscle cell migration
GO:0032224 positive regulation of synaptic transmission, cholinergic
GO:0032230 positive regulation of synaptic transmission, GABAergic
GO:0032355 response to estradiol
GO:0032570 response to progesterone
GO:0035094 response to nicotine
GO:0035106 operant conditioning
GO:0042713 sperm ejaculation
GO:0042755 eating behavior
GO:0043117 positive regulation of vascular permeability
GO:0045471 response to ethanol
GO:0045760 positive regulation of action potential
GO:0045777 positive regulation of blood pressure
GO:0045778 positive regulation of ossification
GO:0045907 positive regulation of vasoconstriction
GO:0046887 positive regulation of hormone secretion
GO:0048265 response to pain
GO:0048266 behavioral response to pain
GO:0048660 regulation of smooth muscle cell proliferation
GO:0050671 positive regulation of lymphocyte proliferation
GO:0050679 positive regulation of epithelial cell proliferation
GO:0051496 positive regulation of stress fiber assembly
GO:0051602 response to electrical stimulus
GO:0060083 smooth muscle contraction involved in micturition
GO:0070472 regulation of uterine smooth muscle contraction
GO:0070474 positive regulation of uterine smooth muscle contraction
GO:1902093 positive regulation of flagellated sperm motility
Cellular Component
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0030425 dendrite
GO:0036126 sperm flagellum
GO:0044297 cell body
GO:0045211 postsynaptic membrane
GO:0061827 sperm head
GO:0071944 cell periphery
GO:0097225 sperm midpiece

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8u26, PDBe:8u26, PDBj:8u26
PDBsum8u26
PubMed37973972
UniProtP25103|NK1R_HUMAN Substance-P receptor (Gene Name=TACR1)

[Back to BioLiP]