Structure of PDB 8s1p Chain R

Receptor sequence
>8s1pR (length=102) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MYAIIKTGGKQIKVEEGQTVYIEKLAAEAGETVTFEDVLFVGGDNVKVGN
PTVEGATVTAKVEKQGRAKKITVFRYKPKKNVHKKQGHRQPYTKVTIEKI
NA
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
ChainR
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R G8 G9 K10 Y21 E23 K24 K64 R67 K69 K70 R75 Y76 K77 P78 K79 K80 N81 V82 K84 K85 Q86 G87 H88 R89 Q90 P91 Y92 G8 G9 K10 Y21 E23 K24 K64 R67 K69 K70 R75 Y76 K77 P78 K79 K80 N81 V82 K84 K85 Q86 G87 H88 R89 Q90 P91 Y92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP26908|RL21_BACSU Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]