Structure of PDB 8r08 Chain R

Receptor sequence

>8r08R (length=106) Species: 9606 (Homo sapiens)

EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK

3D structure

• PDB: 8r08 Structural insights into the cross-exon to cross-intron spliceosome switch
• Chain: R
• Resolution: 6.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	D370 S372 L373 F384 G386 D387 K416 G423 Y424 K456 S457 M458	D2 S4 L5 F16 G18 D19 K48 G55 Y56 K88 S89 M90
BS02	rna	R	D387 R417 S449 R450	D19 R49 S81 R82

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0048025 negative regulation of mRNA splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:8r08, PDBe:8r08, PDBj:8r08
• PDBsum: 8r08
• PubMed: 38778104
• UniProt: Q9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)