Structure of PDB 8qp8 Chain R

Receptor sequence

>8qp8R (length=106) Species: 9606 (Homo sapiens)

EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK

3D structure

• PDB: 8qp8 Structural insights into the cross-exon to cross-intron spliceosome switch
• Chain: R
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	S449 R450 P451	S81 R82 P83
BS02	rna	R	I413 K416 S457 M458	I45 K48 S89 M90

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0048025 negative regulation of mRNA splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:8qp8, PDBe:8qp8, PDBj:8qp8
• PDBsum: 8qp8
• PubMed: 38778104
• UniProt: Q9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)