Structure of PDB 8q5i Chain R

Receptor sequence

>8q5iR (length=140) Species: 5476 (Candida albicans) [Search protein sequence]

STQSVQTFGKKKTATAVAHVKAGKGLIKINGSPITLVQPEILRFKVYEPL
TLVGLDKFQGIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEASK
NELKKIFASYDKTLLVADSRRMEPKKFGGRGARARFQKSY

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	Q7 T8 F9 K13 T14 V18 H20 G70 G71 G72 H73 V74 S75 Q76 K113 V117 S120 R121 R122 M123 E124 P125 K126 K127 F128 R131 G132 R134 A135 R136 F137 Q138 K139 S140 Y141	Q6 T7 F8 K12 T13 V17 H19 G69 G70 G71 H72 V73 S74 Q75 K112 V116 S119 R120 R121 M122 E123 P124 K125 K126 F127 R130 G131 R133 A134 R135 F136 Q137 K138 S139 Y140

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	O94017\|RS16_CANAX Small ribosomal subunit protein uS9 (Gene Name=RPS16)