Structure of PDB 8pjk Chain R

Receptor sequence
>8pjkR (length=286) Species: 9606 (Homo sapiens) [Search protein sequence]
TVSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVT
DLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSIWHLCAIA
LDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRSDPDA
CTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKNERNA
EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPT
LLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII
3D structure
PDB8pjk Discovery of a functionally selective serotonin 1A receptor agonist for the treatment of pain
ChainR
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR R K345 G348 L356 K216 G219 L227
BS02 CLR R Y35 L43 L46 Q97 A383 I384 W387 S391 Y4 L12 L15 Q66 A254 I255 W258 S262
BS03 ZL9 R Y96 Q97 D116 C120 F361 Y390 Y65 Q66 D85 C89 F232 Y261
BS04 T7M R R134 K342 T346 I350 I399 Y400 F403 N404 R103 K213 T217 I221 I270 Y271 F274 N275
Gene Ontology
Molecular Function
GO:0001586 Gi/o-coupled serotonin receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004993 G protein-coupled serotonin receptor activity
GO:0005515 protein binding
GO:0030594 neurotransmitter receptor activity
GO:0051378 serotonin binding
GO:0090722 receptor-receptor interaction
GO:0099589 serotonin receptor activity
Biological Process
GO:0001662 behavioral fear response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007198 adenylate cyclase-inhibiting serotonin receptor signaling pathway
GO:0007210 serotonin receptor signaling pathway
GO:0007214 gamma-aminobutyric acid signaling pathway
GO:0007268 chemical synaptic transmission
GO:0008284 positive regulation of cell population proliferation
GO:0014062 regulation of serotonin secretion
GO:0035640 exploration behavior
GO:0042053 regulation of dopamine metabolic process
GO:0042428 serotonin metabolic process
Cellular Component
GO:0005886 plasma membrane
GO:0030425 dendrite
GO:0042995 cell projection
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pjk, PDBe:8pjk, PDBj:8pjk
PDBsum8pjk
PubMed
UniProtP08908|5HT1A_HUMAN 5-hydroxytryptamine receptor 1A (Gene Name=HTR1A)

[Back to BioLiP]