Structure of PDB 8peg Chain R

Receptor sequence
>8pegR (length=74) Species: 562 (Escherichia coli) [Search protein sequence]
MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAK
YQRQLARAIKRARYLSLLPYTDRH
3D structure
PDB8peg Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
ChainR
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R Y4 R6 R7 R8 K38 I39 S42 K50 Q52 R53 K60 R61 Y64 Y70 Y4 R6 R7 R8 K38 I39 S42 K50 Q52 R53 K60 R61 Y64 Y70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8peg, PDBe:8peg, PDBj:8peg
PDBsum8peg
PubMed38409277
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]