Structure of PDB 8p2h Chain R

Receptor sequence

>8p2hR (length=119) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAEAARESGLEF

3D structure

PDB

8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state

Chain

Resolution

2.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	M1 S3 R14 A16 R17 T20 F94 R96 Y101 R113 F119	M1 S3 R14 A16 R17 T20 F94 R96 Y101 R113 F119
BS02	rna	R	K4 D6 K7 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 Q55 K59 T68 K69 V70 H102 G103 R104	K4 D6 K7 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 Q55 K59 T68 K69 V70 H102 G103 R104

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
PDBsum	8p2h
PubMed	38902339
UniProt	Q2FW22\|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)