Structure of PDB 8k3o Chain R

Receptor sequence
>8k3oR (length=66) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
FCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAI
KRARYLSLLPYTDRHQ
3D structure
PDB8k3o Cryo-EM structure of 30S ribosome with cleaved AP-mRNA bound complex I
ChainR
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R T14 A15 K38 I39 K50 R53 R57 K60 Y70 H74 T5 A6 K29 I30 K41 R44 R48 K51 Y61 H65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k3o, PDBe:8k3o, PDBj:8k3o
PDBsum8k3o
PubMed
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]