Structure of PDB 8jiu Chain R

Receptor sequence

>8jiuR (length=395) Species: 9606 (Homo sapiens) [Search protein sequence]

QVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTT
ANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGE
EIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAI
HANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRV
AAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPM
LFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIV
QLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGT
LRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLG

3D structure

PDB

8jiu Structural analysis of the dual agonism at GLP-1R and GCGR.

Chain

Resolution

2.76 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	R	Q27 V28 M29 L32 W36 Y65 Q122 Q131 V134 Y138 Q142 Y145 Y149 Y202 G207 D209 W215 Q232 I235 T296 N298 W304 R378 L382	Q1 V2 M3 L6 W10 Y39 Q96 Q105 V108 Y112 Q116 Y119 Y123 Y176 G181 D183 W189 Q206 I209 T270 N272 W278 R352 L356
BS02	D6M	R	Q142 T146 V147 S150 L151 R199	Q116 T120 V121 S124 L125 R173

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0004930	G protein-coupled receptor activity
GO:0004967	glucagon receptor activity
GO:0005085	guanyl-nucleotide exchange factor activity
GO:0017046	peptide hormone binding
GO:0038023	signaling receptor activity

	Biological Process
GO:0006091	generation of precursor metabolites and energy
GO:0006887	exocytosis
GO:0007166	cell surface receptor signaling pathway
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007584	response to nutrient
GO:0008217	regulation of blood pressure
GO:0009267	cellular response to starvation
GO:0009755	hormone-mediated signaling pathway
GO:0010628	positive regulation of gene expression
GO:0042593	glucose homeostasis
GO:0042594	response to starvation
GO:0070873	regulation of glycogen metabolic process
GO:0071377	cellular response to glucagon stimulus

	Cellular Component
GO:0005768	endosome
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiu, PDBe:8jiu, PDBj:8jiu
PDBsum	8jiu
PubMed	37549266
UniProt	P47871\|GLR_HUMAN Glucagon receptor (Gene Name=GCGR)

[Back to BioLiP]