Structure of PDB 8jit Chain R

Receptor sequence

>8jitR (length=395) Species: 9606 (Homo sapiens) [Search protein sequence]

QVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTT
ANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGE
EIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAI
HANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRV
AAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPM
LFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIV
QLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGT
LRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLG

3D structure

PDB

8jit Structural analysis of the dual agonism at GLP-1R and GCGR.

Chain

Resolution

2.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	R	Q27 V28 M29 W36 K64 Y65 Q131 A135 Y138 Q142 Y145 Y149 V191 I206 G207 W215 I235 T296 N298 W304 V311 R378 K381 D385 L386	Q1 V2 M3 W10 K38 Y39 Q105 A109 Y112 Q116 Y119 Y123 V165 I180 G181 W189 I209 T270 N272 W278 V285 R352 K355 D359 L360
BS02	D6M	R	S139 Q142 V143 T146 V147 L151 R199	S113 Q116 V117 T120 V121 L125 R173

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0004930	G protein-coupled receptor activity
GO:0004967	glucagon receptor activity
GO:0005085	guanyl-nucleotide exchange factor activity
GO:0017046	peptide hormone binding
GO:0038023	signaling receptor activity

	Biological Process
GO:0006091	generation of precursor metabolites and energy
GO:0006887	exocytosis
GO:0007166	cell surface receptor signaling pathway
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007584	response to nutrient
GO:0008217	regulation of blood pressure
GO:0009267	cellular response to starvation
GO:0009755	hormone-mediated signaling pathway
GO:0010628	positive regulation of gene expression
GO:0042593	glucose homeostasis
GO:0042594	response to starvation
GO:0070873	regulation of glycogen metabolic process
GO:0071377	cellular response to glucagon stimulus

	Cellular Component
GO:0005768	endosome
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jit, PDBe:8jit, PDBj:8jit
PDBsum	8jit
PubMed	37549266
UniProt	P47871\|GLR_HUMAN Glucagon receptor (Gene Name=GCGR)

[Back to BioLiP]