Structure of PDB 8iy5 Chain R

Receptor sequence
>8iy5R (length=316) Species: 9606 (Homo sapiens) [Search protein sequence]
PPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPN
ILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGI
TVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEA
IGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLA
ITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWL
PLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALY
LVSKRFKNCFKSCLCC
3D structure
PDB8iy5 Cryo-EM structure of the endothelin-1-ETB-Gi complex.
ChainR
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide R P88 I94 I157 N158 K161 E165 Q181 M245 Y247 I254 L256 P259 L277 L339 R343 K346 Y350 Q352 R357 L361 L365 D368 Y369 P1 I7 I70 N71 K74 E78 Q94 M158 Y160 I167 L169 P172 L190 L252 R256 K259 Y263 Q265 R270 L274 L278 D281 Y282
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004962 endothelin receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0031702 type 1 angiotensin receptor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001755 neural crest cell migration
GO:0002001 renin secretion into blood stream
GO:0002027 regulation of heart rate
GO:0006885 regulation of pH
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007194 negative regulation of adenylate cyclase activity
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007399 nervous system development
GO:0007422 peripheral nervous system development
GO:0007497 posterior midgut development
GO:0008015 blood circulation
GO:0008217 regulation of blood pressure
GO:0008284 positive regulation of cell population proliferation
GO:0010467 gene expression
GO:0014043 negative regulation of neuron maturation
GO:0014070 response to organic cyclic compound
GO:0014826 vein smooth muscle contraction
GO:0019722 calcium-mediated signaling
GO:0019934 cGMP-mediated signaling
GO:0030202 heparin metabolic process
GO:0030318 melanocyte differentiation
GO:0031620 regulation of fever generation
GO:0032341 aldosterone metabolic process
GO:0032496 response to lipopolysaccharide
GO:0035645 enteric smooth muscle cell differentiation
GO:0035810 positive regulation of urine volume
GO:0035812 renal sodium excretion
GO:0042045 epithelial fluid transport
GO:0042310 vasoconstriction
GO:0042311 vasodilation
GO:0043066 negative regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043473 pigmentation
GO:0048066 developmental pigmentation
GO:0048246 macrophage chemotaxis
GO:0048265 response to pain
GO:0048484 enteric nervous system development
GO:0050678 regulation of epithelial cell proliferation
GO:0051248 negative regulation of protein metabolic process
GO:0055078 sodium ion homeostasis
GO:0060070 canonical Wnt signaling pathway
GO:0060406 positive regulation of penile erection
GO:0061028 establishment of endothelial barrier
GO:0065008 regulation of biological quality
GO:0070294 renal sodium ion absorption
GO:0070588 calcium ion transmembrane transport
GO:0071222 cellular response to lipopolysaccharide
GO:0071806 protein transmembrane transport
GO:0072112 podocyte differentiation
GO:0086100 endothelin receptor signaling pathway
GO:0097018 renal albumin absorption
GO:0097402 neuroblast migration
GO:0160093 chordate pharynx development
GO:1904383 response to sodium phosphate
GO:1990839 response to endothelin
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0031965 nuclear membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8iy5, PDBe:8iy5, PDBj:8iy5
PDBsum8iy5
PubMed37096326
UniProtP24530|EDNRB_HUMAN Endothelin receptor type B (Gene Name=EDNRB)

[Back to BioLiP]