Structure of PDB 8iug Chain R

Receptor sequence
>8iugR (length=39) Species: 120962 (Roseiflexus castenholzii) [Search protein sequence]
DRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRA
3D structure
PDB8iug New insights on the photocomplex of Roseiflexus castenholzii revealed from comparisons of native and carotenoid-depleted complexes.
ChainR
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 MQE R V13 L17 V11 L15
BS02 BCL R H27 W38 H25 W36
BS03 BCL R I26 H27 I24 H25
BS04 U4Z R G19 M22 G17 M20
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8iug, PDBe:8iug, PDBj:8iug
PDBsum8iug
PubMed37468106
UniProtQ83XD1

[Back to BioLiP]