Structure of PDB 8irt Chain R

Receptor sequence
>8irtR (length=273) Species: 562,9606 [Search protein sequence]
YYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVAT
LVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYT
AVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRIPLREKKA
TQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSA
LNPVIYTTFNIEFRKAFLKILSC
3D structure
PDB8irt Structural genomics of the human dopamine receptor system.
ChainR
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 R5F R D110 V111 C114 S192 S196 W342 F345 F346 H349 T369 Y373 D80 V81 C84 S162 S166 W215 F218 F219 H222 T242 Y246
Gene Ontology
Molecular Function
GO:0001591 dopamine neurotransmitter receptor activity, coupled via Gi/Go
GO:0004930 G protein-coupled receptor activity
GO:0004952 dopamine neurotransmitter receptor activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0001963 synaptic transmission, dopaminergic
GO:0002031 G protein-coupled receptor internalization
GO:0006874 intracellular calcium ion homeostasis
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007195 adenylate cyclase-inhibiting dopamine receptor signaling pathway
GO:0007611 learning or memory
GO:0007612 learning
GO:0007626 locomotory behavior
GO:0008542 visual learning
GO:0009410 response to xenobiotic stimulus
GO:0014059 regulation of dopamine secretion
GO:0022900 electron transport chain
GO:0032467 positive regulation of cytokinesis
GO:0032922 circadian regulation of gene expression
GO:0034776 response to histamine
GO:0035176 social behavior
GO:0042220 response to cocaine
GO:0042417 dopamine metabolic process
GO:0043266 regulation of potassium ion transport
GO:0043278 response to morphine
GO:0043410 positive regulation of MAPK cascade
GO:0045471 response to ethanol
GO:0045776 negative regulation of blood pressure
GO:0045840 positive regulation of mitotic nuclear division
GO:0046717 acid secretion
GO:0048148 behavioral response to cocaine
GO:0048715 negative regulation of oligodendrocyte differentiation
GO:0050482 arachidonate secretion
GO:0050709 negative regulation of protein secretion
GO:0050883 musculoskeletal movement, spinal reflex action
GO:0051481 negative regulation of cytosolic calcium ion concentration
GO:0051584 regulation of dopamine uptake involved in synaptic transmission
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0051967 negative regulation of synaptic transmission, glutamatergic
GO:0060134 prepulse inhibition
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0060161 positive regulation of dopamine receptor signaling pathway
GO:0071880 adenylate cyclase-activating adrenergic receptor signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0042597 periplasmic space
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8irt, PDBe:8irt, PDBj:8irt
PDBsum8irt
PubMed37221270
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P35462

[Back to BioLiP]