Structure of PDB 8ie3 Chain R

Receptor sequence

>8ie3R (length=225) Species: 9606 (Homo sapiens) [Search protein sequence]

QNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHK
QRHAEKIQMKKTIKMHEKRNIKQKRKEKAGKWEVPLPKVRAQGETEVLKV
IRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKAHVTH
PELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGK
VIWGKYAQVTNNPENDGCINAVLLV

3D structure

PDB

8ie3 Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	N4 E5 Y6 I7 E8 K26 S29 R30 A32 H33 S36 A39 K40 K41 I43 L45 K48 L49 H51 K58 I59 K107 K123 R125 R137 T138 G139 K140 R141 K142 K143 K144 A145 H182 K189 T191 D251 N255	N2 E3 Y4 I5 E6 K24 S27 R28 A30 H31 S34 A37 K38 K39 I41 L43 K46 L47 H49 K56 I57 K72 K88 R90 R102 T103 G104 K105 R106 K107 K108 K109 A110 H147 K154 T156 D216 N220

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000460	maturation of 5.8S rRNA
GO:0000470	maturation of LSU-rRNA
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ie3, PDBe:8ie3, PDBj:8ie3
PDBsum	8ie3
PubMed	37491604
UniProt	O95478\|NSA2_HUMAN Ribosome biogenesis protein NSA2 homolog (Gene Name=NSA2)

[Back to BioLiP]