Structure of PDB 8id3 Chain R

Receptor sequence
>8id3R (length=291) Species: 9606 (Homo sapiens) [Search protein sequence]
RTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRR
GATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLS
GSVTILTLAAVSLERMVCIVHLQRGARAVLLALIWGYSAVAALPLCVFFR
VVPQREISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQIT
KASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITI
LLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTL
3D structure
PDB8id3 Unsaturated bond recognition leads to biased signal in a fatty acid receptor.
ChainR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 7NR R F27 D208 F211 I280 I281 F6 D174 F177 I246 I247
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0008527 taste receptor activity
GO:0042277 peptide binding
Biological Process
GO:0001818 negative regulation of cytokine production
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0010827 regulation of D-glucose transmembrane transport
GO:0030154 cell differentiation
GO:0032691 negative regulation of interleukin-1 beta production
GO:0032870 cellular response to hormone stimulus
GO:0036321 ghrelin secretion
GO:0043066 negative regulation of apoptotic process
GO:0045444 fat cell differentiation
GO:0045669 positive regulation of osteoblast differentiation
GO:0046879 hormone secretion
GO:0050728 negative regulation of inflammatory response
GO:0050872 white fat cell differentiation
GO:0050873 brown fat cell differentiation
GO:0050912 detection of chemical stimulus involved in sensory perception of taste
GO:0070094 positive regulation of glucagon secretion
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0090275 negative regulation of somatostatin secretion
GO:0090336 positive regulation of brown fat cell differentiation
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030139 endocytic vesicle
GO:0042995 cell projection
GO:0060170 ciliary membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8id3, PDBe:8id3, PDBj:8id3
PDBsum8id3
PubMed36862765
UniProtQ5NUL3|FFAR4_HUMAN Free fatty acid receptor 4 (Gene Name=FFAR4)

[Back to BioLiP]