Structure of PDB 8iap Chain R |
>8iapR (length=83) Species: 10090 (Mus musculus) [Search protein sequence] |
ITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVNEVEHRIIACD GGGGALGHPKVYINLDKETKTGTCGYCGLQFKQ |
|
PDB | 8iap Respiratory complex Peripheral Arm of CI, focus-refined map of type I, Wild type mouse under thermoneutral temperature |
Chain | R |
Resolution | 3.2 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
R |
C79 H88 C104 C107 |
C49 H58 C74 C77 |
|
|
|