Structure of PDB 8i0v Chain R

Receptor sequence
>8i0vR (length=380) Species: 9606 (Homo sapiens) [Search protein sequence]
EPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQ
VDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEA
IKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFN
SGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTV
KEQQEWKIPPCISNWKNAKGYTIPLDKRLAAVHINENFAKLAEALYIADR
KAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGDGEARERDE
IRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPEVQYD
QRLFNQSKGMDSGFAGGEDEIYNVYDQAWR
3D structure
PDB8i0v Molecular basis for the activation of human spliceosome
ChainR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R S370 R371 A372 P374 S316 R317 A318 P320
BS02 rna R N256 A257 K258 N217 A218 K219
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0003723 RNA binding
GO:0005112 Notch binding
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0019899 enzyme binding
GO:0042809 nuclear vitamin D receptor binding
GO:0042974 nuclear retinoic acid receptor binding
GO:0046332 SMAD binding
GO:0050681 nuclear androgen receptor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000398 mRNA splicing, via spliceosome
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043923 positive regulation by host of viral transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0048384 retinoic acid receptor signaling pathway
GO:0048385 regulation of retinoic acid receptor signaling pathway
GO:0050769 positive regulation of neurogenesis
GO:0070562 regulation of vitamin D receptor signaling pathway
GO:0070564 positive regulation of vitamin D receptor signaling pathway
GO:0071300 cellular response to retinoic acid
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0008024 cyclin/CDK positive transcription elongation factor complex
GO:0016363 nuclear matrix
GO:0016604 nuclear body
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0v, PDBe:8i0v, PDBj:8i0v
PDBsum8i0v
PubMed39068178
UniProtQ13573|SNW1_HUMAN SNW domain-containing protein 1 (Gene Name=SNW1)

[Back to BioLiP]