Structure of PDB 8hu1 Chain R

Receptor sequence
>8hu1R (length=66) Species: 562 (Escherichia coli) [Search protein sequence]
KFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARA
IKRARYLSLLPYTDRH
3D structure
PDB8hu1 Structural insights into the decoding capability of isoleucine tRNAs with lysidine and agmatidine
ChainR
Resolution2.69 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K38 I39 P41 K50 Q52 R53 K60 R61 R63 Y64 Y70 K30 I31 P33 K42 Q44 R45 K52 R53 R55 Y56 Y62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hu1, PDBe:8hu1, PDBj:8hu1
PDBsum8hu1
PubMed38538915
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]