Structure of PDB 8hn8 Chain R

Receptor sequence
>8hn8R (length=276) Species: 562,9606 [Search protein sequence]
STRITLAFLMSLLAFAIMLGNAVVILAFVVDKNLRHRSNYFFLNLAISDF
FVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDR
YQSVSNAVSYRTQHTGILKIVTLMVAVWVLAFLVNGPMILVSESWKDEGS
ECEPGFFSEWYILAITSFLEFLVPVILVAYFNMYIYWSLWKRGHLELLRA
RKLAKSLAILLGVFAVCWAPYSLFTIVLSFYPSATRPKSVWYRIAFWLQW
FNSFVNPFLYPLCHKRFQKAFLKIFC
3D structure
PDB8hn8 Structure insights into Histamine H4 receptor activation by an endogenous ligand histamine and agonist imetit
ChainR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HSM R D94 Y95 C98 F344 Q347 D82 Y83 C86 F246 Q249
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004969 histamine receptor activity
GO:0004993 G protein-coupled serotonin receptor activity
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0016907 G protein-coupled acetylcholine receptor activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007197 adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007268 chemical synaptic transmission
GO:0008150 biological_process
GO:0022900 electron transport chain
GO:0043408 regulation of MAPK cascade
GO:0098664 G protein-coupled serotonin receptor signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0042597 periplasmic space
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hn8, PDBe:8hn8, PDBj:8hn8
PDBsum8hn8
PubMed
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
Q9H3N8|HRH4_HUMAN Histamine H4 receptor (Gene Name=HRH4)

[Back to BioLiP]