Structure of PDB 8gur Chain R

Receptor sequence
>8gurR (length=282) Species: 9606 (Homo sapiens) [Search protein sequence]
MKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYL
FIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASV
GSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMG
WTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVA
SLSGHQMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKA
FAFCSMLCLINSMVNPVIYALRSGEIRSSAHH
3D structure
PDB8gur Structural basis of selective cannabinoid CB 2 receptor activation.
ChainR
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 9GF R F87 F94 I110 V113 T114 F117 L182 F183 P184 F281 S285 F66 F73 I89 V92 T93 F96 L161 F162 P163 F251 S255
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004949 cannabinoid receptor activity
GO:0005515 protein binding
Biological Process
GO:0001975 response to amphetamine
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0019222 regulation of metabolic process
GO:0030595 leukocyte chemotaxis
GO:0032229 negative regulation of synaptic transmission, GABAergic
GO:0032496 response to lipopolysaccharide
GO:0033004 negative regulation of mast cell activation
GO:0038171 cannabinoid signaling pathway
GO:0045759 negative regulation of action potential
GO:0099553 trans-synaptic signaling by endocannabinoid, modulating synaptic transmission
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
GO:0042995 cell projection
GO:0043025 neuronal cell body
GO:0043204 perikaryon
GO:0045211 postsynaptic membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gur, PDBe:8gur, PDBj:8gur
PDBsum8gur
PubMed36922494
UniProtP34972|CNR2_HUMAN Cannabinoid receptor 2 (Gene Name=CNR2)

[Back to BioLiP]