Structure of PDB 8fyt Chain R

Receptor sequence

>8fytR (length=286) Species: 562,9606 [Search protein sequence]

YQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLM
VSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSIWHLCAIALDR
YWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDP
DACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKKNERNA
EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPT
LLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII

3D structure

PDB

8fyt Structural pharmacology and therapeutic potential of 5-methoxytryptamines.

Chain

Resolution

2.64 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	7LD	R	F112 D116 V117 C120 T121 I189 W358 F361 F362 N386	F78 D82 V83 C86 T87 I155 W229 F232 F233 N257
BS02	J40	R	R134 K345 T346 I399 Y402 F403 N404	R100 K216 T217 I270 Y273 F274 N275
BS03	Y01	R	L46 Q97 T379 L380 A383 W387 L395	L12 Q63 T250 L251 A254 W258 L266
BS04	Y01	R	R341 V344 K345 G348 I349 G352 L356 C357 L388	R212 V215 K216 G219 I220 G223 L227 C228 L259

Gene Ontology

	Molecular Function
GO:0001586	Gi/o-coupled serotonin receptor activity
GO:0004930	G protein-coupled receptor activity
GO:0004993	G protein-coupled serotonin receptor activity
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0030594	neurotransmitter receptor activity
GO:0051378	serotonin binding
GO:0090722	receptor-receptor interaction
GO:0099589	serotonin receptor activity

	Biological Process
GO:0001662	behavioral fear response
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007198	adenylate cyclase-inhibiting serotonin receptor signaling pathway
GO:0007210	serotonin receptor signaling pathway
GO:0007214	gamma-aminobutyric acid signaling pathway
GO:0007268	chemical synaptic transmission
GO:0008284	positive regulation of cell population proliferation
GO:0014062	regulation of serotonin secretion
GO:0019229	regulation of vasoconstriction
GO:0022900	electron transport chain
GO:0035640	exploration behavior
GO:0042053	regulation of dopamine metabolic process
GO:0042428	serotonin metabolic process
GO:0046883	regulation of hormone secretion
GO:0050795	regulation of behavior

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0030425	dendrite
GO:0042597	periplasmic space
GO:0042995	cell projection
GO:0045202	synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fyt, PDBe:8fyt, PDBj:8fyt
PDBsum	8fyt
PubMed	38720072
UniProt	P08908\|5HT1A_HUMAN 5-hydroxytryptamine receptor 1A (Gene Name=HTR1A); P0ABE7\|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)

[Back to BioLiP]