Structure of PDB 8flt Chain R

Receptor sequence
>8fltR (length=266) Species: 9606 (Homo sapiens) [Search protein sequence]
ETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHL
FLSFMLRAVSIFVKDAVLYSGYAGCRVAVTFFLYFLATNYYWILVEGLYL
HSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSS
GNKKWIIQVPILASIVLNFILFINIVRVLATKLRETTRQQYRKLLKSTLV
LMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFC
NGEVQAEIKKSWSRWT
3D structure
PDB8flt Molecular insights into peptide agonist engagement with the PTH receptor.
ChainR
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R E180 R181 F184 R233 Y245 F288 L289 L292 D353 L354 Q364 L368 T427 Y429 T430 M441 E444 M445 N448 E4 R5 F8 R57 Y69 F82 L83 L86 D147 L148 Q158 L162 T215 Y217 T218 M229 E232 M233 N236
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004991 parathyroid hormone receptor activity
GO:0005515 protein binding
GO:0008528 G protein-coupled peptide receptor activity
GO:0017046 peptide hormone binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0001501 skeletal system development
GO:0001503 ossification
GO:0001701 in utero embryonic development
GO:0002062 chondrocyte differentiation
GO:0002076 osteoblast development
GO:0006874 intracellular calcium ion homeostasis
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0030282 bone mineralization
GO:0045453 bone resorption
GO:0048469 cell maturation
GO:0060732 positive regulation of inositol phosphate biosynthetic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0043235 receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8flt, PDBe:8flt, PDBj:8flt
PDBsum8flt
PubMed37148874
UniProtQ03431|PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor (Gene Name=PTH1R)

[Back to BioLiP]