Structure of PDB 8f7s Chain R

Receptor sequence
>8f7sR (length=289) Species: 9606 (Homo sapiens) [Search protein sequence]
SLALAIAITALYSAVCAVGLLGNVLVMFVIVRYTKMKTATNIYIFSLALA
GALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYSMFTSIFTLTMMCV
DRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDG
AVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVR
LLSGSKEKDRSLRRITRMVLVVVVAFVVCWAPIHIFVIVWTLVDIDRRDP
LVVAALHLCIALGYINSSLNPVLYAFLDENFKRCFRQLC
3D structure
PDB8f7s Structures of the entire human opioid receptor family.
ChainR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide R Q105 K108 W114 D128 Y129 M132 V197 C198 K214 I277 W284 I304 Y308 Q61 K64 W70 D84 Y85 M88 V153 C154 K170 I233 W240 I260 Y264
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004985 G protein-coupled opioid receptor activity
GO:0005515 protein binding
GO:0033612 receptor serine/threonine kinase binding
GO:0038046 G protein-coupled enkephalin receptor activity
GO:0042923 neuropeptide binding
Biological Process
GO:0006955 immune response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0008344 adult locomotory behavior
GO:0010629 negative regulation of gene expression
GO:0031333 negative regulation of protein-containing complex assembly
GO:0032793 positive regulation of CREB transcription factor activity
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0035094 response to nicotine
GO:0038003 G protein-coupled opioid receptor signaling pathway
GO:0042755 eating behavior
GO:0045471 response to ethanol
GO:0051881 regulation of mitochondrial membrane potential
GO:0051924 regulation of calcium ion transport
GO:0071363 cellular response to growth factor stimulus
GO:0071456 cellular response to hypoxia
GO:0097237 cellular response to toxic substance
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030672 synaptic vesicle membrane
GO:0031982 vesicle
GO:0032590 dendrite membrane
GO:0042734 presynaptic membrane
GO:0043005 neuron projection
GO:0043679 axon terminus
GO:0045211 postsynaptic membrane
GO:0097444 spine apparatus
GO:0098839 postsynaptic density membrane
GO:0098992 neuronal dense core vesicle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8f7s, PDBe:8f7s, PDBj:8f7s
PDBsum8f7s
PubMed36638794
UniProtP41143|OPRD_HUMAN Delta-type opioid receptor (Gene Name=OPRD1)

[Back to BioLiP]