Structure of PDB 8f7r Chain R

Receptor sequence

>8f7rR (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]

SMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALA
DALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSV
DRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQG
SIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVR
MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTF
QTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF

3D structure

PDB

8f7r Structures of the entire human opioid receptor family.

Chain

Resolution

3.28 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	R	Q126 N129 Y130 W135 I146 D149 C219 V238 W320 H321	Q61 N64 Y65 W70 I81 D84 C154 V173 W255 H256
BS02	CLR	R	K187 W194	K122 W129
BS03	CLR	R	Y301 S319	Y236 S254
BS04	CLR	R	F158 L196 A199 I200 F241	F93 L131 A134 I135 F176
BS05	CLR	R	W228 Y229 N232 L233 I236	W163 Y164 N167 L168 I171
BS06	CLR	R	Y168 V252 L256	Y103 V187 L191
BS07	CLR	R	I236 I240 I244 L307	I171 I175 I179 L242
BS08	CLR	R	V165 H173 K176	V100 H108 K111

Gene Ontology

	Molecular Function
GO:0001965	G-protein alpha-subunit binding
GO:0004930	G protein-coupled receptor activity
GO:0004979	beta-endorphin receptor activity
GO:0004985	G protein-coupled opioid receptor activity
GO:0005245	voltage-gated calcium channel activity
GO:0005515	protein binding
GO:0031681	G-protein beta-subunit binding
GO:0038047	morphine receptor activity
GO:0042923	neuropeptide binding

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007197	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218	neuropeptide signaling pathway
GO:0007600	sensory perception
GO:0008285	negative regulation of cell population proliferation
GO:0019233	sensory perception of pain
GO:0038003	G protein-coupled opioid receptor signaling pathway
GO:0048149	behavioral response to ethanol
GO:0050769	positive regulation of neurogenesis
GO:0061358	negative regulation of Wnt protein secretion
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0070588	calcium ion transmembrane transport
GO:0071315	cellular response to morphine
GO:0080135	regulation of cellular response to stress
GO:2000310	regulation of NMDA receptor activity

	Cellular Component
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0030424	axon
GO:0030425	dendrite
GO:0042995	cell projection
GO:0043005	neuron projection
GO:0043204	perikaryon
GO:0045202	synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8f7r, PDBe:8f7r, PDBj:8f7r
PDBsum	8f7r
PubMed	36638794
UniProt	P35372\|OPRM_HUMAN Mu-type opioid receptor (Gene Name=OPRM1)

[Back to BioLiP]