Structure of PDB 8f7q Chain R

Receptor sequence

>8f7qR (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]

SMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALA
DALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIWTLCTMSV
DRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQG
SIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVR
MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTF
QTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF

3D structure

PDB

8f7q Structures of the entire human opioid receptor family.

Chain

Resolution

3.22 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	R	Q126 L131 G133 V145 I146 Y150 M153 V238 W320 I324	Q61 L66 G68 V80 I81 Y85 M88 V173 W255 I259
BS02	CLR	R	F110 Y151 K187	F45 Y86 K122
BS03	CLR	R	P297 Y301 I304	P232 Y236 I239
BS04	CLR	R	I200 M207 W230 L234 F241	I135 M142 W165 L169 F176
BS05	CLR	R	W228 Y229 N232 I236	W163 Y164 N167 I171
BS06	CLR	R	I236 I240	I171 I175
BS07	CLR	R	V165 H173 K176	V100 H108 K111

Gene Ontology

	Molecular Function
GO:0001965	G-protein alpha-subunit binding
GO:0004930	G protein-coupled receptor activity
GO:0004979	beta-endorphin receptor activity
GO:0004985	G protein-coupled opioid receptor activity
GO:0005245	voltage-gated calcium channel activity
GO:0005515	protein binding
GO:0031681	G-protein beta-subunit binding
GO:0038047	morphine receptor activity
GO:0042923	neuropeptide binding

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007197	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218	neuropeptide signaling pathway
GO:0007600	sensory perception
GO:0008285	negative regulation of cell population proliferation
GO:0019233	sensory perception of pain
GO:0038003	G protein-coupled opioid receptor signaling pathway
GO:0048149	behavioral response to ethanol
GO:0050769	positive regulation of neurogenesis
GO:0061358	negative regulation of Wnt protein secretion
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0070588	calcium ion transmembrane transport
GO:0071315	cellular response to morphine
GO:0080135	regulation of cellular response to stress
GO:2000310	regulation of NMDA receptor activity

	Cellular Component
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0030424	axon
GO:0030425	dendrite
GO:0042995	cell projection
GO:0043005	neuron projection
GO:0043204	perikaryon
GO:0045202	synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8f7q, PDBe:8f7q, PDBj:8f7q
PDBsum	8f7q
PubMed	36638794
UniProt	P35372\|OPRM_HUMAN Mu-type opioid receptor (Gene Name=OPRM1)

[Back to BioLiP]