Structure of PDB 8eit Chain R

Receptor sequence
>8eitR (length=268) Species: 9606,10665 [Search protein sequence]
LPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSD
LLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSA
GRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGTSLG
INTPVSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALAR
SGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLG
LITGAWSVVLNPLVTGYL
3D structure
PDB8eit Molecular mechanism of fatty acid activation of FFAR1.
ChainR
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.2.1.17: lysozyme.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HXA R V84 F87 Y91 L138 R183 L186 Y240 V82 F85 Y89 L136 R172 L175 Y229
Gene Ontology
Molecular Function
GO:0003796 lysozyme activity
GO:0004930 G protein-coupled receptor activity
GO:0008289 lipid binding
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0045125 bioactive lipid receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0009253 peptidoglycan catabolic process
GO:0016998 cell wall macromolecule catabolic process
GO:0030073 insulin secretion
GO:0031640 killing of cells of another organism
GO:0032024 positive regulation of insulin secretion
GO:0032691 negative regulation of interleukin-1 beta production
GO:0042593 glucose homeostasis
GO:0042742 defense response to bacterium
GO:0044659 viral release from host cell by cytolysis
GO:0051928 positive regulation of calcium ion transport
GO:0070542 response to fatty acid
GO:0099105 ion channel modulating, G protein-coupled receptor signaling pathway
GO:1990806 ligand-gated ion channel signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eit, PDBe:8eit, PDBj:8eit
PDBsum8eit
PubMed37216523
UniProtO14842|FFAR1_HUMAN Free fatty acid receptor 1 (Gene Name=FFAR1);
P00720|ENLYS_BPT4 Endolysin (Gene Name=E)

[Back to BioLiP]