Structure of PDB 8efq Chain R

Receptor sequence
>8efqR (length=283) Species: 9606 (Homo sapiens) [Search protein sequence]
MITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALAD
ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVD
RYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGS
IDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRM
LSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQ
TVSWHFCIALGYTNSCLNPVLYAFLDENFKRCF
3D structure
PDB8efq Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
ChainR
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R Q126 N129 V145 D149 H299 V302 Q60 N63 V79 D83 H233 V236
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0004930 G protein-coupled receptor activity
GO:0004979 beta-endorphin receptor activity
GO:0004985 G protein-coupled opioid receptor activity
GO:0005245 voltage-gated calcium channel activity
GO:0005515 protein binding
GO:0031681 G-protein beta-subunit binding
GO:0038047 morphine receptor activity
GO:0042923 neuropeptide binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007197 adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007600 sensory perception
GO:0008285 negative regulation of cell population proliferation
GO:0019233 sensory perception of pain
GO:0038003 G protein-coupled opioid receptor signaling pathway
GO:0048149 behavioral response to ethanol
GO:0050769 positive regulation of neurogenesis
GO:0061358 negative regulation of Wnt protein secretion
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070588 calcium ion transmembrane transport
GO:0071315 cellular response to morphine
GO:0080135 regulation of cellular response to stress
GO:2000310 regulation of NMDA receptor activity
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043204 perikaryon
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8efq, PDBe:8efq, PDBj:8efq
PDBsum8efq
PubMed36368306
UniProtP35372|OPRM_HUMAN Mu-type opioid receptor (Gene Name=OPRM1)

[Back to BioLiP]