Structure of PDB 8efo Chain R

Receptor sequence

>8efoR (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]

SMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALA
DALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSV
DRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQG
SIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVR
MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTF
QTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF

3D structure

PDB

8efo Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	8QY	R	I146 D149 Y150 M153 V238 V302 Y328	I81 D84 Y85 M88 V173 V237 Y263
BS02	CLR	R	M101 F110 N111 K187 W194	M36 F45 N46 K122 W129
BS03	CLR	R	P297 Y301 S319	P232 Y236 S254
BS04	CLR	R	F158 L196 A199 I200 F241	F93 L131 A134 I135 F176
BS05	CLR	R	W228 N232 I236	W163 N167 I171
BS06	CLR	R	Y168 I249 V252	Y103 I184 V187
BS07	CLR	R	V165 I169 H173 K176	V100 I104 H108 K111
BS08	CLR	R	I236 I240 L307	I171 I175 L242

Gene Ontology

	Molecular Function
GO:0001965	G-protein alpha-subunit binding
GO:0004930	G protein-coupled receptor activity
GO:0004979	beta-endorphin receptor activity
GO:0004985	G protein-coupled opioid receptor activity
GO:0005245	voltage-gated calcium channel activity
GO:0005515	protein binding
GO:0031681	G-protein beta-subunit binding
GO:0038047	morphine receptor activity
GO:0042923	neuropeptide binding

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007197	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218	neuropeptide signaling pathway
GO:0007600	sensory perception
GO:0008285	negative regulation of cell population proliferation
GO:0019233	sensory perception of pain
GO:0038003	G protein-coupled opioid receptor signaling pathway
GO:0048149	behavioral response to ethanol
GO:0050769	positive regulation of neurogenesis
GO:0061358	negative regulation of Wnt protein secretion
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0070588	calcium ion transmembrane transport
GO:0071315	cellular response to morphine
GO:0080135	regulation of cellular response to stress
GO:2000310	regulation of NMDA receptor activity

	Cellular Component
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0030424	axon
GO:0030425	dendrite
GO:0042995	cell projection
GO:0043005	neuron projection
GO:0043204	perikaryon
GO:0045202	synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8efo, PDBe:8efo, PDBj:8efo
PDBsum	8efo
PubMed	36368306
UniProt	P35372\|OPRM_HUMAN Mu-type opioid receptor (Gene Name=OPRM1)

[Back to BioLiP]