Structure of PDB 8d8j Chain R

Receptor sequence
>8d8jR (length=57) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
DIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIR
RCQAIGL
3D structure
PDB8d8j Principles of mitoribosomal small subunit assembly in eukaryotes.
ChainR
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R R108 I109 Q122 R123 R124 S126 K127 R130 R131 Q133 A134 R28 I29 Q42 R43 R44 S46 K47 R50 R51 Q53 A54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d8j, PDBe:8d8j, PDBj:8d8j
PDBsum8d8j
PubMed36482135
UniProtP40033|RSM18_YEAST Small ribosomal subunit protein bS18m (Gene Name=RSM18)

[Back to BioLiP]