Structure of PDB 8cgu Chain R

Receptor sequence
>8cguR (length=66) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
KFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARA
IKRARYLSLLPYTDRH
3D structure
PDB8cgu Structural conservation of antibiotic interaction with ribosomes.
ChainR
Resolution1.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna R K38 I39 S42 K50 Q52 R53 R57 K60 R61 R63 Y64 Y70 H74 K30 I31 S34 K42 Q44 R45 R49 K52 R53 R55 Y56 Y62 H66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8cgu, PDBe:8cgu, PDBj:8cgu
PDBsum8cgu
PubMed37550453
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]