Structure of PDB 8c3a Chain R

Receptor sequence
>8c3aR (length=129) Species: 5476 (Candida albicans) [Search protein sequence]
MVDATAPKKRTFKQFSFKGVDLKDLVEMPTEEFTKLCGARVRRRFSRGLD
SKPMGLIKKLRAARAATEPNERPAVVKTHLRNMIVVPEMIGSVVGVYNGK
VFNTVEIKPEMVGHYLGEFSITYTPVRHG
3D structure
PDB8c3a New crystal system to promote screening for new eukaryotic inhibitors
ChainR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R A74 V75 A74 V75
BS02 rna R K18 A39 R40 R42 R43 R47 K59 K77 H79 R81 N82 N98 G99 K100 Y115 T122 Y123 T124 V126 H128 K18 A39 R40 R42 R43 R47 K59 K77 H79 R81 N82 N98 G99 K100 Y115 T122 Y123 T124 V126 H128
BS03 MG R Y97 G99 K100 Y97 G99 K100
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum8c3a
PubMed
UniProtA0A1D8PK22|RS15_CANAL Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]