Structure of PDB 8bpx Chain R |
>8bpxR (length=73) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
VGNHTAKWMQDRSKKSPMELISEVPPIKVDGRIVACEGDTNPALGHPIEF ICLDLNEPAICKYCGLRYVQDHH |
|
PDB | 8bpx Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution. |
Chain | R |
Resolution | 2.09 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
R |
C72 H82 C97 C100 |
C36 H46 C61 C64 |
|
|
|
|